PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10003558m
Common NameCICLE_v10003558mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family NF-YB
Protein Properties Length: 215aa    MW: 24113.6 Da    PI: 6.1559
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10003558mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.53e-5638133297
            NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 
                      +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrktingdd++wa++tlGfedyv+plk+yl+kyre+eg
  Ciclev10003558m  38 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGDDIIWAITTLGFEDYVAPLKLYLSKYREIEG 131
                      89*******************************************************************************************9 PP

            NF-YB  96 ek 97 
                      ek
  Ciclev10003558m 132 EK 133
                      96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-5431159IPR009072Histone-fold
SuperFamilySSF471137.66E-4140154IPR009072Histone-fold
PfamPF008084.1E-2843107IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.4E-197189No hitNo description
PROSITE patternPS0068507490IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.4E-1990108No hitNo description
PRINTSPR006152.4E-19109127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MEDDSHGNGP NGPDGGSPES PCVKSSGSNS NNNNHNNKEQ DRFLPIANVG RIMKKVIPGN  60
GKISKDAKET VQECVSEFIS FVTGEASDKC QREKRKTING DDIIWAITTL GFEDYVAPLK  120
LYLSKYREIE GEKLNIPKQQ RSEQRVQQQQ QQQQSHEHEQ QLPYSSVYSS TNLMSQSPFM  180
ATDHHHQSFP LPFSPNSIQK QLQPQDQIDS VGNW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4538128292Transcription factor HapC (Eurofung)
4g92_B1e-4538128292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432153.11e-160hypothetical protein CICLE_v10003558mg
RefseqXP_006465083.11e-160PREDICTED: nuclear transcription factor Y subunit B-7
SwissprotQ9SIT96e-72NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLV4SCS61e-160V4SCS6_9R
STRINGGLYMA05G32680.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.18e-70nuclear factor Y, subunit B7